McDonnell Genome Institute

Washington University

CircRNA

chr15|59030803|59081284|+|RNF111|ENST00000348370.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

137

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

MMQHPTLSLK

Amino Acids from 5' Exons

AFLKVSHVSMDSIRALHLKSGYEEDSFCTKDTGESERDPFASRAHWGSQKFSCRSDDSGEILSPVFSKAREGNEWPARTRKKSRCEEKTQKPAGWPFVCAELCRKPGNIRTEATPRDTKRFLFLSFFSFISAFWRFYCDFRGRSLCKTFPDHFECKKPCTVSVASDDRICIGIVNEKTLFTWQFVTETSMQKEICKKFLTEDTETKREDINAEEETRSVSSKKICLATFFQEPQQILFLINRRRRFVCFCQKPPKQSSCSL,LSLKFPMSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNCVKENQGILGLRQHLGTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPCRKRFVKNNSSQRTQKQKERILMQRKKREVLARRKYALLPSSSSSSENDLSSESSSSSSTEGEEDLFVSASENHQNNPAVPS,FPSFPCLNGLLNITSSTPKWIRVRFLLMHQRHRRVKGSFCIQSPLGQPKVFLQELRLIVKWGMNSLTCVMILKSKRRKMVTSKNKKKVSLGKNAKASRLALRMCRIVLKKTREYDGNTGHQVMKIMIPLLVIVFLLLHLVCILEILILLQMRIKKSLDIPRPFMLKVEAIVHGLISGLGLRQNLYRDCKDPVYMAVRYGDFHAERDLKIIPHRGHRNKKRGYCRGRNEKCLEENMPCYLVLVVPVRMTSAVNPLLAHQLKEKKICLFLPVKTTKTIQLFPQ

Amino Acids from 3' Exons

MPLQGHFIIKLLPARILMETPLLRLSLRLKWIMLFLILYMLSILKYLLMQHLILWHPHHQLTPVQLHQSLSIFLLHTSQFRTIFQPQHLQHRDCILMKCRGWKFKGGGCSIQ,CLFDKATSSSSFCLPAFSWKPPSSDSASASSGLCYSSSCTCFPFSNIFSCNISSCGTPTTNSLSQYSCTNPSASSSYTPANFAPYSSHSTSSTETASSSDAEDGSSKEEDDAASN,ASLTRPLHHQASACPHSHGNPPPQTQPPPQVDYVIPHPVHAFHSQISSHATSHPVAPPPPTHLASTAAPIPQHLPPTHQPISHHIPATAPPAQRLHPHEVMQRMEVQRRRMMQHP