McDonnell Genome Institute

Washington University

CircRNA

chr15|58610296|58633359|-|ADAM10|ENST00000260408.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9341

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

KVNSIQMVRR

Amino Acids from 5' Exons

WTHQLVPVQGLCSGVGTSVVEPSPCNLDPLATILEVTVMFSCGADMLMVLLGLKKQFLVQSSMKTLLNGL,GPINLCQYRVCAVEALQWSNHHPATWIPLQRFRLLCFHAVQISRCWSSSAKSNFSRALKHCMDC,DPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKKAIFSPELYENIAEWIV

Amino Acids from 3' Exons

EALEEYVKKVNSIQMVRRSPTLELLLFRTMGLMYLPKSLTLLLLTKLDITLDP,KLWRNMKKTLFRWEEVLKHWNYYCSELWVSCTSQSLSHYFCSRSWTLWIP,SSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSP