McDonnell Genome Institute

Washington University

CircRNA

chr15|57604268|57646669|+|GCOM1|ENST00000496627.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

6

Peptide

KVQEQPGK

Amino Acids from 5' Exons

ANVCRLRLTVPPESPVPEQCEKKIERKEQ,QMFADYGPYLLRVQFLSNVKRRLREKS,KCLQTTADRTSESSSAMKEDEKRA

Amino Acids from 3' Exons

IMSHELFSRFSLRLFGRVGSLLWVGSDSFIVRDKNTCTLSAGKRWYLSMMSQTKQEGHIIRKIPCGALVCENTHILSPLVQPQTAESRELTDPQSIFRNLSRHRRNCNEKGYKTIQKDPGGGLEDESLLMEKLPKTSAKEMGRELEECCSGKEVLPPDHPQESTGAA,SCRTSSSPDLVSGSLEDDKLVACSGLEAIPLLFVIRRTLVHSLLGRGGIYLANEQNRKDILFKGKFDHVGLLFVKTPTYCHPDLYSLKLQSQENSQIHRVFLGTVDIEEGTAMKKATEKPFRKIQVEAWKMNPYLWKSCQRHLLRRWEESLKNVSALGRRCSHQITPKKVQEQP,HVARALLQISPALWKMISWPALGWKRFLYCSLEEHLYTLCWEEVVFIYDEPMNKTGRTYYLKENLTMWGSCLKHPHTVTLTCTASNCRVKRTHRSTEYFELETLKKELQKRLLKNHSERSRWRLGRILTYGKAAKDICGDGKRARMLVLWEGGAPTRSPPRKYRSSQ