McDonnell Genome Institute

Washington University

CircRNA

chr15|57523488|57524751|+|CGNL1|ENST00000281282.5

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9683

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

4

Peptide

MQDEGNLSQTTQEQK

Amino Acids from 5' Exons

GNLSQTTQEQKQLSEKLKEESEQKEQLRRLKNEMENERWHLGKTIEKLQKE,EIVRLPRSRSSCLRSSKRRVSRRSSEGRTRWRMSGGTWAKPLRNCRR,KSESDYPGAEAVVEAQRGEAEGAAKKVEERDGEAVAPGQNHETAEG

Amino Acids from 3' Exons

MADIVEASRTSTLELQNQLDEYKEKNRRELAEMQRQLKEKTLEAEKSRLTAMKMQDE,WQTLLRPPVPQPWSSRTSWMSIRRKTAGSSQKCKDSRRKRWRQKSPDQPKCRM,GRHCGLPYLNPGAPEPAGVGEKPQGARRNAKTVEGENAGGRKVPTDSHENAG