McDonnell Genome Institute

Washington University

CircRNA

chr15|57516779|57518497|+|CGNL1|ENST00000281282.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9415

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

9

Peptide

LENELEAAQNVEVLASR

Amino Acids from 5' Exons

NVEVLASRSNTSEQDQAGTEMRVKLLQEENEKLQGRSEELERRVAQLQRQIEDLKGDEAKAKETLKKYE,MSRSWRAGATLQSKTRRGLKCASFCRRRMRSCREEAKSWSGELLSFKGRSRTKAMKPRRRKRRST,CRGLGEQEQHFRARPGGDNAREASAGGEEAAGKKRRAGAESCSASKADRGPERRSQGEGNAEEVR

Amino Acids from 3' Exons

GEIRQLEEALVHARKEEKEAVSARRALENELEAAQ,EKYDSRRPLCTPERKKKKLCQPEGPWRMNWRLL,RNTTVRGGPCARQKGRKRSCVSQKGPGETGGCS