McDonnell Genome Institute

Washington University

CircRNA

chr15|54235029|54300373|+|UNC13C|ENST00000260323.15

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.989

30

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

16

10

Peptide

YGIESIYQAMTAGGGLYGIDSMPDLR

Amino Acids from 5' Exons

GWRWTLWYQHAGSSQKKNFAYCPRC,AGGGLYGIDSMPDLRRKKTLPIVRDV,LEVDFMVLTACRIFAEKKLCLLSEM

Amino Acids from 3' Exons

NLFHYLTEVKSNGGVKIPEVKGDEAWKVFFDDASQEIVDEFAMRYGIESIYQAM,ICSITLKNLMVEKSQKSKGMKPGRFSLMMLPKKLMNLLCVMELNPFIKL,SVPLLDSEIWWSENPRSQRGSLEGFLCFPRNSICYALWNIHLSSYD