McDonnell Genome Institute

Washington University

CircRNA

chr15|52384160|52389363|-|MYO5A|ENST00000356338.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9863

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

TVGHQMPK

Amino Acids from 5' Exons

FKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQ,LRCYQNYFKMMRRPSVQLQPPPQGAHPSHELLQSPPKADQAKWPKSTRKQWGI,DATRTISREGHQSNFSHLLRAHTPHTNSCKAHQRQTRPNGQRAQENSGAS

Amino Acids from 3' Exons

MPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADK,CLKAQMTPGPKNCTTHITNVHSLKSLVYQTKLSSSNILLT,ARHRHLGPKIVQHTFEQMCTLKASSIKQSFHHPTFCQ