McDonnell Genome Institute

Washington University

CircRNA

chr15|52370168|52410476|-|MYO5A|ENST00000356338.10

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9364

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

6

Peptide

QETEQSIGNAK

Amino Acids from 5' Exons

NKDYKCLVEKLTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQETEQ,TKTTNALWRNPIWKEYTTLRLRNYEVTNVFNVKRKRKLPLGGSLVCRKKLPSSGKTWSKLVQRKNALRNMQIDTNKKQS,QRLQMPCGETNQSGRNIQLDETTKLRTSSTKRGSESCHWAGPSAGRNCQAPERPGANSFREKMHGTCRSIQTRNRA

Amino Acids from 3' Exons

SIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQ,PLEMLKQPGMIIAAVLGSILRLVLIRDIESLVPIELIFRNPEWYS,HWKCNNQEQPFWEVYDWFEISNHWCQYENLSFREIQSGIP