McDonnell Genome Institute

Washington University

CircRNA

chr15|52351253|52370417|-|MYO5A|ENST00000356338.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.947

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

5

Peptide

EAIQPKNKDYK

Amino Acids from 5' Exons

RQELESENKKLKNELNELRKALSEKSAPEVTAPGAPAYRVLMEQLTSVSEELDVRKEEVLILRSQLVSQKEAIQPK,VKNNQKTKNRMSMSCARPSVRKVPQRPPQVHLPTVSSWSSPLARSLMSARRKSSSGLNWARKRPSNP,SRTRIRKQKTEEAKVAQGPQEKCPRGDRPRCTCLPCPHGAADLCERGACPQGGSPHLKVSTGEPERGHPTQ

Amino Acids from 3' Exons

NKDYKCLVEKLTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQETEQ,TKTTNALWRNPIWKEYTTLRLRNYEVTNVFNVKRKRKLPLGGSLVCRKKLPSSGKTWSKLVQRKNALRNMQIDTNKKQS,QRLQMPCGETNQSGRNIQLDETTKLRTSSTKRGSESCHWAGPSAGRNCQAPERPGANSFREKMHGTCRSIQTRNRA