McDonnell Genome Institute

Washington University

CircRNA

chr15|52124472|52126044|-|GNB5|ENST00000261837.11

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9946

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LLDTMITLSTSGMFSK

Amino Acids from 5' Exons

VACCLLDTMITLSTSGMFSKGPGSPSCLDMKTALALYEFPPMGLLSALDHGIIPS,SPAVCWIQLHYQRLGCSQRVPGLHPVWTKPRHSTSFPRWDCFLLWIMGSYPQ,RLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLR

Amino Acids from 3' Exons

CRLYDLRADREVAIYSKESIIFGASSVDFSLS,VASMTCGQIGRLPSIPKKASYLEHPAWTSPSV,SPLPAGRGGCHLFQRKHHIWSIQRGLLPQ