McDonnell Genome Institute

Washington University

CircRNA

chr15|50912077|50997883|+|AP4E1|ENST00000261842.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9582

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

13

Peptide

SADLEIFPAENFKEEEK

Amino Acids from 5' Exons

EEEKLIQQELSSLKATVSAPTTTL,KKKNSSRNVVKRLFLLLLQH,RRKINPAGTESESDCFCSYYNT

Amino Acids from 3' Exons

LGKADTVSHKFRRKSKVKEAKSGETTSTHNMTCSSFSSLSNVAYEDDYYSNTLHDTGDKELKKFSLTSELLDSESLTELPLVEKFSYCSLSTPSLFANNNMEIFHPPQSTAASVAKESSLASSFLEETTEYIHSNAMEVCNNETISVSSYKIWKDDCLLMVWSVTNKSGLELKSADLEIFPAENFK,WEKQILSLTSSEGNQKSKKLKVAKQPVLIIPVLPLVLCQMWHMKMIIIRILCTIQETRNRNFLSLQNFWILSHSQNCPWLRNSHIVVCLHLHCLLITTWKFFTLLNLLQPQLPRKALLHLFWKKLLNTYTQMLWKSVIMKLYQCLLIKFGKMIVYWSGQSLIRVVWNKVLTKFFLQKIS,GKSRYCLSQVQKEIKSQRSKWRNNQYSYDLFFLFFVKCGIRLLFEYFARYRRQGIKEIFSHFRTFGFVTHRTALGEILILSVYTFIVCQHGNFSPSSIYCSLSCQGKLFSFIFFGRNYIHTLKCYGSLNYISVFLNLERLFIDGLVSHEWFGIEKCLRNFSCRKFQ