McDonnell Genome Institute

Washington University

CircRNA

chr15|50599121|50612829|-|TRPM7|ENST00000313478.11

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9953

91

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

9

Peptide

LMIDTVMEEGK

Amino Acids from 5' Exons

VANMFYIVVIMALVLLSFGVPRKAILYPHEAPSWTLAKDIVFHPYWMIFGEVYAYEID,WPICSTLLWLLYYLVLVFPERQYFILMKHHLGLLLKIFFTHTGFLVKFMHTKLM,GQYVLHCSDYGSCITFWCSQKGNTLSSSTILDSCRYSFSPILDDFWSLCIRN

Amino Acids from 3' Exons

IDTVMEEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWACLMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYS,LIQLWKKERRKEPKMKLTLMIQKPSAFLIHLMNFFGLALRGRSWPVFYGNMVKNQWLKHLPVRSIVQWHMKQSRVTWMILQKNNSIP,YSYGRRKEEKNQRNCRHSRNQALSLSTTFNLGLPYEEAGHGPFFMATWRINGSISCLDLSFNGISKAEPGRYFRRTKTVFQ