McDonnell Genome Institute

Washington University

CircRNA

chr15|50458999|50476993|+|USP8|ENST00000307179.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9011

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

9

Peptide

RQNEEVSISYMK

Amino Acids from 5' Exons

IRSSPEKTGKRQAGGSTAATTKKAGNRKRGWWHIGRLFGECFGFQRQNPK,YEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQK,MKKLKSGKNLRKKTGRRKHSGYNKKGRKQEERMVAHWLKALWRMFWIPKTKPK

Amino Acids from 3' Exons

WESKTVLRNEPLVLEGGYENWLLCYPQYTTNAKVTPPPRRQNEEVSIS,GKVKLSCAMSLWFREAMKTGSFVIPSIQQMLRSLHPHDARMKRCLSH,GKNCPAQAFGFRGRLKLAPLLSPVYNKCGHSTPTTPERGVYL