McDonnell Genome Institute

Washington University

CircRNA

chr15|48537610|48644950|-|FBN1|ENST00000316623.9

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9068

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

GALQGAAAAADR

Amino Acids from 5' Exons

ITGQAHVLLSATRCARDNSAGLSAQKRSAVPQSAEPGATPVRCVLPSLTPAAVASFQISARELVK,LQDRPMFYCDQQPDVPGTTQRDCLHKNALLCHSRPSLGPPLDVSCPASPLPPWLHSKYPHGSLS,YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIRTGACQ

Amino Acids from 3' Exons

LAGAASGSSAWRRREEPGPGDGRRDSGTPAARCASGRSGGRRPSPGRGKRRREPVAARHHASRASAGDRPGIYRAFSVLHEPWGGRQFGGWEREGNQSQSGQEKRRWRTRRAR,WQGPPEVGAAPGEGGRSPARGTGGGIAGPRRRGALQGAAAAADRAPGAARGGGSRWRLGIMRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGHDALK,GRGRLKWEQRLEKAGGARPGGRAAGRDPGGAVRFRAQRRPQTEPRARQEAAGAGGGSASCVEGVCWRSPWDLPCFRPTRAMGRTPIWRLGTRKPEPVGPREEAVEDTTRLK