McDonnell Genome Institute

Washington University

CircRNA

chr15|44629232|44633637|-|SPG11|ENST00000261866.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9745

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

2

Peptide

ELFIHTEGR

Amino Acids from 5' Exons

MWKSYQHWIYFARQLEKVILNPKANTFQNNCLILHCLSLTTKRSFSFTLK,CGRADTSIGFTLLGNRKLFTPKQTLFRTIASYTVFPQPNKGAFHSH,VEELIPALDLLCSAIRESYSEPQSKHFSEQLLNLTLSFLNNQIKELFIHTE

Amino Acids from 3' Exons

AGIENRQLDTVNFFLKSKENLFNPSSKSSVSDQFDHLSSHLYLR,PGKIVSWTQISFRARKIFLIHPQNLLYLISLITCHPIYIE,RDRKSSAGHSKFLFEEQGKSFSILKIFCISVSLVIPFIFK