McDonnell Genome Institute

Washington University

CircRNA

chr15|44626330|44626507|-|SPG11|ENST00000261866.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9924

48

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

NMEVIASAILNNK

Amino Acids from 5' Exons

EVIASAILNNKIPEAQTFFRIDSHSAQKLEELIGIGLNLVFDNLKKNNIKEASELLKNM,KLLPAPFTTKYQRHRLSSGLIVILLKNLRSLLAAIWSLTIKRTIRKPLNFRI,SYCQRHFKQQNTRGTDFLQDSFCSKTGAYWHRPKFGLQFKKEQYKGSLTFEEY

Amino Acids from 3' Exons

EVIASAILNNKIPEAQTFFRIDSHSAQKLEELIGIGLNLVFDNLKKNNIKEASELLKNM,KLLPAPFTTKYQRHRLSSGLIVILLKNLRSLLAAIWSLTIKRTIRKPLNFRI,SYCQRHFKQQNTRGTDFLQDSFCSKTGAYWHRPKFGLQFKKEQYKGSLTFEEY