McDonnell Genome Institute

Washington University

CircRNA

chr15|44569397|44622347|-|SPG11|ENST00000261866.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9067

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

5

Peptide

LDPVEILK

Amino Acids from 5' Exons

VRLLTGIGRYNEMTYIFDLLHKKHYFEVLMRKKLDP,YGSSLALEGTTRHTYLICCIKSTTLKCGRSWI,TAPHWHWKVQRDDIHIFAAKALLSANEEEVGS

Amino Acids from 3' Exons

VEILKEKNYFSEKEKRTIDFVHQVEKLYLGHFQENMQIQSFP,LKFKKKIIFLKKRKELTSCIKLRSFIWDISKKICKSSHFP,NFKRKKLFFKREKNYRLRASSEALFGTFPRKYANPVISQ