McDonnell Genome Institute

Washington University

CircRNA

chr15|43766727|43770329|+|PDIA3|ENST00000300289.9

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9418

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

GVMMVAK

Amino Acids from 5' Exons

GNDGGKEIPGCWAQTQLCCSPQNLPTFFWLGEHCWRDSCCCYQNCRREVCHAGGVL,VMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEF,WWQRNSWMLGTNSTLLLAAKPLAMNFLILAWRALLERFLLLLSELLKERSLSCRRSS

Amino Acids from 3' Exons

LSKDPNIVIAKMDATANDVPSPYEVR,SAKTQISSPRWMPQPMMCLLHMKSE,QQRPKYRHSQDGCHSQCAFSISQR