McDonnell Genome Institute

Washington University

CircRNA

chr15|43447365|43470066|-|TP53BP1|ENST00000263801.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9126

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

18

Peptide

RHSTPIDKPMDTSVLSEEGGEPFQK

Amino Acids from 5' Exons

KPHFISLCLKKVISSHHLVQPHLLLGTNWSPRDTVLLL,NPISFHFARRYHPTIDWCNPTSYWAPKIGAQETQYSY,TPFHFTLPKEGDIIPPLTGATPPLIGHLKLEPKRHSTPI

Amino Acids from 3' Exons

ISQWTRQCYLKKEESLFRRNFKVVNQWSKTPLSCLSPLYHHKPQHQYLRAHQSSLLGHFLSHPSLSFL,ANGHVSVIRRRRAFSEETSKWTSGVRKPPSPAVHCITTSLNTNISEHTSLPSWVTSYPIPASVFS,KPMDTSVLSEEGGEPFQKKLQSGEPVELENPPLLPESTVSPQASTPISQSTPVFPPGSLPIPSQPQFSH