McDonnell Genome Institute

Washington University

CircRNA

chr15|43383302|43386330|+|TUBGCP4|ENST00000260383.11

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9051

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

21

Peptide

LLQSCTVSSSSHSSAWWTLNR

Amino Acids from 5' Exons

NPGRLSWGHVTALSLDAPWTPLGPARILYQTGAIFWCQCPARRGRGGSGHWGTDRKTTERTAGL,ILAVCHGVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQDL,SWPFVMGSCINSSQPGCSMDSSWTSMKNSLSNRGHLLVMSVPSQKRTRRIWALGDQENNENCRT

Amino Acids from 3' Exons

DPFKTRKTLLLQSCTVSSSSHSSAWWTLNRWWIAFAALWL,IHFEKPGRHFCCRAAPSQAAATLQLGGLTGGGSHSQHCG,SILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAE