McDonnell Genome Institute

Washington University

CircRNA

chr15|43189198|43191675|+|CCNDBP1|ENST00000300213.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9825

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

19

Peptide

KDQVAQLDDIVDISDEISPR

Amino Acids from 5' Exons

ETQKFCEQVHAAIKAFIAVYYLLPKDQ,KPRSSVNKSMLPSRHLLQCTICFQRIR,NPEVLTSPCCHQGIYCSVLFASKGS

Amino Acids from 3' Exons

AVEECDPYSGLLNDTEENNSDNHNHEDDVLGFPSNQDLYWSEDDQELIIPCLALVRASKACLKKIRMLVAENGKKDQVAQLDDIVDISDEISP,LWKNVTLTLASMILRRTTLTTTIMRMMCWGFPAIRTCIGQRTIKSSSHALRWEHPKPARKFGCWQRMGRRIRWHSWMTLWIFLMKSAL,CGRMPLLWPLEYGEQLQPQSGCVGVSQQSGLVLVRGRSRAHNPMPCAGESIQSLPEENSDVSGREWEEGSGGTAGHCGYFNQP