McDonnell Genome Institute

Washington University

CircRNA

chr15|43135511|43149151|+|TMEM62|ENST00000260403.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9594

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

IIGGDLTDAK

Amino Acids from 5' Exons

ETQMPKQRNSWDPGSMRNGKPTRVFRRQESWKKPSGWISKEIM,RPDRCQNKGTVGIQAAGRMANLPGYSEEDKSHGKNQVAGYQRKS,DLTDAKTKEQLGSRQHEVEWQTYQGILKKTRVMEKTKWLDIKGNH

Amino Acids from 3' Exons

FGYSLFVWTSPYTWWTDACFAHSSLPGHFGTGGRLEGE,SAIAYLCGHLHTLGGLMPVLHTRHFQGTLELEVGDWKDNR,RLLICVDISIHLVDCLFCTLVTSRALWNLRWETGRIIG