McDonnell Genome Institute

Washington University

CircRNA

chr15|43015687|43021375|-|UBR1|ENST00000290650.8

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9971

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

1

Peptide

EDSIMEEER

Amino Acids from 5' Exons

ITHDKEKAERKRKAEAARLHRQKIMAQMSALQKNFIETHKLMYDNTSEMPGKEDSIMEEE,LLMIKKKQNEKEKLKLLGYIARRSWLRCLPYRKTSLKLINSCMTIHQKCLGKKIPLWRKR,YSRKSRTKKKSSCATSPEDHGSDVCLTEKLHNSTHVQYIRNAWERRFHYGGRE

Amino Acids from 3' Exons

DWEVQPIYKCFWKNSKEFPSKARRTRGYF,IGKFSHEYTNAFGKTQRNSPVRRPEGHDNVDTS,LGSSAMNIQMLLEKLKGIPQLEGQKDMITWILQ