McDonnell Genome Institute

Washington University

CircRNA

chr15|43002554|43070925|-|UBR1|ENST00000290650.8

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9332

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

3

Peptide

LPSLQISVQYCDPHYSFATSK

Amino Acids from 5' Exons

VFSCTAELSAAHSCPFLGKWRISLPSLQISVQYCDPHYSFATSKDKQ,YFEAVQLSSQQRIHVDLFDLESGEYLCPLCKSLCNTVIPIIPLQPQKIN,ILKLYSALSSAFMLTFLTWKVENIFALFANLCAILSPLFLCNLKRT

Amino Acids from 3' Exons

NSRCPLNEEVIVQARKIFPSVIKYVVEMTIWEEEKELPPELQI,IHAVRMKRLSKPGKYFLQNMSKLYGKRKKNCLLNSR,FTLSVERGNCPSQENISFSDKICRRNDYMGRGKRTASTPDK