McDonnell Genome Institute

Washington University

CircRNA

chr15|42684115|42695880|+|STARD9|ENST00000290607.11

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9922

38

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AFLWGQR

Amino Acids from 5' Exons

HFPKLGSLYHIATAPYTPNIRENIIRRAFATGCFLPCKDRVPPQERPAFLRSWAALHSQSSLGQEGSLSSRRLPHHESQLCWHPGNGDGGAAPSDGEPGLSISEEISQTKAKAAKDLHLYYPDQRGEGTSRPPHTSWVAKRREPWDPQGCGSQLQFLVSSWTQADCWARKGSQDFLDRIQTTFSKQGIKKASEGSGNGQKYYQKVLSLASWQSFEETTKYKGPRHHGPTHRFQPSNGSFKRKRQFIHRQLLIGFSLMCLCQSPDRATEARGEEMGFPRARELKQPTIGLTGEEVPKPQKQARGQSSHQQPWPTQDQNSFCEGLHCSLRQPTCSNSELLLGPDCRGRTGGRSARRTFPWFSRDTHRDFLAPGGLSACNGPRGNMQAWSHQLQNSSAGCRPANEQFVLPSSVPTPLAPTPLAPTPLAPAPLAGITGRAKLLTSRLSPRHAAFKREPTDVHGFLVFLLDQPQQPPRNSGFFMSKSYAGISLLGGEAWILAKYGTKAIRCRNGSAILQTAPRQYAPLQCKRAHSLCCYVAVSLGNSKAYSTRSWHLSGQMYPHDPAGQLSIPQFRIKRAGCLCHHLDSCRQHPKGLVCPSAEVPPTLLSCFGGHRSTQASLPLPGRLWFPGPSFQRRRYSIASWPGIQSESQQLSSPSVQNQAFEGRERTGQFKCQIRRCFRFLHERGELRNLFGRLRIIVCFSIYKCTGLCNRERDTRFHDRSMSQAEQLGRMPSELQETWTDDFLGFFPEERLSQCHYSHQSRPLVPRLGSSQEKCSPARAIKSRQPLPTRGREDRLPGELGSSKTHKCFLCPSFRSRAIPSLCSLESIVIFPAAPTLGNILCDQKQGCPDRNCLRDSSLQRSKGTLPTPQGSLGLWSQPPSSPRCLFEEFASAVTKPEFDCLISAGHSDTSSEYQGSHQRIRMPWKYYRRKPFSLFFCYSEQTFSPLYQHKSMIKPSCNFKKTQFSSTGRRGHCSVLLRCFLRQHVWEVSPLSIGTRGRRAGSEYGSEADHQCKPERHARGKCCFFEIQISRSSKQPSDGGPGWWPNPVGREKNWASKRSSSQRLRRVASRYKACIKVPVSCMPSGKKPQMQVTRNVKSQQRTFWKETEKSYNGANECNAAGKWHLRNIAEAGSCFPHTRNRGVGVPGPEGAGEDPCLARQLWKPFALGSAIFSKTDRYCLGSWSDGGQHWEPSPGPENHPKPLQVKGRCTRETCERAHPPSWIGQTCQGYLFFRETHNLQRVHQHFSSPTENESIGSSAIATQAREVFEWPVCKSISKSQRAALGLRKSGIGDCERFSGKPSSTRKFQPRRAKSSRSRNAYAKGRQPSGRKSDSEISSQPALGHVFQAGNCQPITKPDRILYSSSSPRPEYLALEFSKVAKKVSSCTCCSRHLFTLCAGSHNVENSQSLGNWSRASGPEYGDQKPQPRRKCRAFLGTHCLVWVCAIHGHGISSIWCTREHSSGDRGQDLSKHQPPRPWKGPQNHLAGFQYQRFCFSRGGCTKRNKSQFTEQGLPAKEGQLLLGRGPSQQAKAEGREGDGRRTDQRCFLSTCFPAEGAQSRAAVGALPCIHVPGHLGGDQTGKGPEKAASLCGQGHSPFLLNFTRTRMFFKGCWQASVTNRPVIIRPDQEGSTGISCGISICSRADRSVTEESPGHISVCRQLISAQYGNQRAMGSCAGFLPCCSCSRQETSYWRTEAVRGSKTIYMSLFFNHREKERCNQNTFLSSFGPRQSSFFSTCGGGQEGSIKEGSGCLTFSGPLSSDSAAKSVSSAGDCRGHTPWQSGQQPRASGTQNSRHHIWRSFRFVSDCTGRKNSPFKSVCDLCSEFYKCLRAARPCPMPGFYWLRRGKSQTRYHSAWSSDKGCTGSSHTAVCAVGECWVWVDRSLQGWQQTFQANSTARSKTKRKSWGNWGGSPMTPKGSFRWPCLLKEPRQQDSQPVREREQNSSLPTAMQFSTCCYSCLFLPFLYFTVFRWPREGAFQGCPTYYPPTLCSTFQGLNGDRRDLGTCALDTWPAQRCQGIANREQHLAFYCGCCPISSSRLQIPFCSREDRFLQPLSYWKRGVNRGSEKGCEASKHRTGCLFPCRHVLAPEAVGQLCRPECTGVSNQSRTTCNNSGTTHPGFKRVCEQVGGRATAMFRKYHMFFGKATIFHVEGSQSLGFPSQVCSKVKTYLQPPGRQSLAGRRAAQRPGFRWWRRLRPGCESPSRWLRWLSDFRCWERGGGCGQASCVQDFITGLQRPSHCVLEAKNTAACCSEEWPPLHWQRAASTQPQGLTSCDYNLLWPQTLQVLPHTTVLSCRLFSFSSGAELECGASFPYRRRYTGAQIVEPTSQGLFLRKVSGKNISAGGQQSESLISLGWDYRSQAPEACHPSLSNAFHSLTHANPFHDQLDVWYFGTSPTGKARETGCPGARKLVLSDGQRNAALWLQHQSLCAAVASGGACTYQLEAVYVWQCSRCFLQPEAPGADTIKCGPVLQHGQWPRRPELPFPLPPQHLRQYLSVNHTQQHECPGFKGLGSIPREFFNCLRRPPHPDEPRSSPHFGSQKASVQGPFWSRLSEEAPLGQRKCCRSSGDYAAVSIRGRLPCGTDQDEHIRTGHTDPRQQAPLEQHHLLCSASQCSISLSGLMDQHAQSVSPPLTAPAQYLRAAWESLPARCGQKGAEHQEGHPRSPTGPDDGWLYSDHCGGQPDPHLTHPVPPDFRGTSGSQCDPRARLRYLDCVSRRGRCARGTSEERGRGNSTENGSAPLSSGRKHSLQAPEPFNTLIPLEVSESPRWAASSFCEPLSFCFPASQLPARGVILLSCQQSQSQLPSFPRALSQYFRVSWGLQGPEEAGPHKCFVRGQGLLPNPHSCQHPRAGSFPRLFDPLSPFNSPCRPPEALQPRPCCPKDSNGLFPNHRVRWLPERKFLTKEWEILPVALPTQPTAESKTPIFLRAAPSAASAQDNYRGPKQTAATTTEAQEPKAGQQLCAEGGFPGALPTERGAKSVAEQDRKWREFSISRGTTTHSGPTFFMGRPPAPQPLPCLVDYCRAPRFCLGPPSGLPTGVTVLQLPDVHGPAPAPQSEGPPGAQILVWGSEGLTWGVGHDGGAGGQRSQLKAGTESPTTSPQPGFVVQEGADPPASWGPEPLTQRGTHRSETAPWLWGGRCPAPGAAEWDRGGACCTCDIHLEGALCT,IFLSWDPSTTLPPRPDPTHQTSEKTSSEEHLPQAASYPARTGCLRKNGLHSSGHGQPCTARAALARKGASAPDACLTMSPNSVGIQEMEMGVKQPHQMVSQGLASLRKSANKLKPRHEPKIFTSTTQTRGAKGLADPSHTQAGWRKEGNLGTHKAAKGASCNSLYPHGPRQTAGHGKAVKTFWTEYKPPSPSRASKRHQRVLATRVRNITKKSSHLPLGSPLKRQQNTRDPDTMVPLTDFSPVMDHSREKDNDLSDTDSNYSLDSLSCVYAKALIEPLKPEERKWDFPEPENSESDDSQLSEDSLAEKRYQSPKNRLGGNRPTNNRGQPRTRTRASVRGFTAASDSDLLAQTHRSFSLDSLIDAEEELGEDQQEEPFPGSADEIPTETFWHLEDSSLPVMDQEAICRLGPINYRTAARLDAVLPMSSSFYLDPQFQPHCELQPHCELQPHCELQPHCEQAESQVEPSYSEQADSLQGMQLSRESPLMSMDSWFSCDSKINPSSPPGIVGSLCPSPDMQEFHSCKGERPGYWPNTEELKPSDAETVLPYSSKLHQGSTELLCSARDEHTASAADTSRLSLWGIQRLIQPGADGTFQGRCIPDMTQQGSSEASHNSSVSNVLAASATTLTHVGSTHERDWSALQQKYLLELSCPVLEAIGAPKPAYPYLEEDSGSLAQASSKGGDTLLPVGPRVSSNLNLNNFPVHLSRIRRLRAEKEQDSLNAKLEGVSDFFSTSEKEASYDETYSADLESLSASRSTNAQVFATENAIPDSMTEACEVKQNNLEECLQSCRKPGLMTSSDEDFFQKNACHSNVTTATKADHWSQGWAPLRKNSAVQPGQLSPDSHYPLEEEKTDCQESSKEAVRRHINVSFALPSGPELYLHSAPWNPLSSSLQPPLLETFYVTKSRDALTETALEIPACREVRVPSPPPREAWGFGHNHQALQGAYLKNNLPVLLQNQNSKIASSQQVTAEIPVDLNTREVIRESGKCPGNITEESHDSVYSSVTQNRHFLPSTSTKVCEFENQVVILNKKHSFPALEGGEVTAQSCCGASSDSTESGKSLLFRESEAREEEELDQNTVLRQTINVSLEKDMPGESAVSLKSRSVDRRVSSPVMVAQGGGPTPKWEGKNETGLLEKGLRPKDSSEEFKLPGTKPAYERFQLVACPQERNPSECKSQEMLNPNREPSGKKQNKRVNNTDEMARLIRSVMQLENGILEIESKQNKQVHASHTPGTDKELVFQDQKEQEKTDHAFRPDSSGNPLPSKDQPSSPRQTDDTVFRDSEAGAMEVNSIGNHPQVQKITPNPFRSREGVRESEPVREHTHPAGSDRPARDICDSLGKHTTCREFTNTSLHPQRMKALARALPLQPRLERSSKNNGQFVKASASLKGQPWGLGSLEELETVKGFQESQVAEHVSSSNQEEPKAQGKVEEMPMQRGGSLQEENKVTQKFPSLSQLCRDTFFRQETVSPLLSRTEFCTAPLHQDLSNTLPLNSPRWPRRCLHVPVALGISSLDCVLDLTMLKIHNSPLVTGVEHQDQSTETRSHSPEGNVRGRSSEAHTAWCGSVRSMAMGSHSQSGVPESIPLGTEDRISASTSPQDHGKDLRITLLGFSTSEDFASEAEVAVQKEIRVSSLNKVSSQPEKRVSFSLEEDSDQASKPRQKAEKETEDVGLTSGVSLAPVSLPRVPSPEPRLLEPSDHASMCLAILEEIRQAKAQRKQLHDFVARGTVLSYCETLLEPECSSRVAGRPQCKQIDQSSSDQTRNEGEAPGFHVASLSAEAGQIDLLPDERKVQATSLSADSFESLPNTETDREPWDPVQAFSHAAPAQDRKRRTGELRQFAGASEPFICHSSSSEIIEKKKDATRTPSSADPLAPDSPRSSAPVEEVRRVVSKKVVAALPSQAPYDDPRVTLHELSQSVPQETAEGIPPGSQDSSPEHQEPRTLDTTYGEVSDNLLVTAQGEKTAHFESQSVTCDVQNSTSASGPKQDHVQCPEASTGFEEGRASPKQDTILPGALTRVALEAPTQQCVQCKESVGSGLTEVCRAGSKHSRPIPLPDQRPSANPGGIGEEAPCRHPREALDGPVFSRNPEGSRTLSPSRGKESRTLPCRQPCSSQPVATHAYSSHSSTLLCFRDGDLGKEPFKAAPHTIHPPCVVPSRAYEMDETGEISRGPDVHLTHGLEPKDVNREFRLTESSTCEPSTVAAVLSRAQGCRSPSAPDVRTGSFSHSATDGSVGLIGVPEKKVAEKQASTELEAASFPAGMYSEPLRQFRDSSVGDQNAQVCQTNPEPPATTQGPHTLDLSEGSAESKLVVEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQEEEQHRDQASGGGEGFAQGVNPLPDEDGLDGCQILDAGREEVAVAKPPVSKILSQGFKDPATVSLRQNETPQPAAQRSGHLYTGREQPAPNHRGSLPVTTIFSGPKHSRSSPTPQFSVVGSSRSLQELNLSVEPPSPTDEDTQGPNRLWNPHLRGYSSGKSVARTSLQAEDSNQKASSRLDDGTTDHRHLKPATPPYPMPSTLSHMPTPDFTTSWMSGTLEQAQQGKREKLGVQVRPENWCSQMDKGMLHFGSSDISPYALPWRPEEPARISWKQYMSGSAVDVSCSQKPQGLTLSNVARCSSMDNGLEDQNSPFHSHLSTYANICDLSTTHSSTENAQGSNEAWEVFRGSSSIALGDPHIPTSPEGVAPTSGHDRRPQFRGPSGEADCLRSKPPLAKGSAAGPVDEIMLLYPSEAGCPVGQTRTNTFEQGTQTLGSRRHWSSTDISFAQPEASAVSAFDLASWTSMHNLSLHLSQLLHSTSELLGSLSQPDVARREQNTKRDIPDKAPQALMMDGSTQTTVDEGSQTDLTLPTLCLQTSEAEPQGANVILEGLGSDTSTVSQEEGDVPGVPQKREAEETAQKMAQLLYLQEESTPYKPQSPSIPSSHLRFQKAPVGQHLPSVSPSVSDAFLPPSSQPEESYCLVVSSPSPSSPHSPGLFPSTSEYPGDSRVQKKLGPTSALFVDRASSPILTLSASTQEPGLSPGSLTLSAPSTHPVEGHQKLDSSPDPVDAPRTPMDNYSQTTDELGGSQRGRSSLQRSNGRSFLELHSPHSPQQSPKLQFSFLGQHPQQLQPRTTIGVQSRLLPPPLRHRSQRLGNSFVPEKVASPEHCPLSGREPSQWQSRTENGGESSASPGEPQRTLDRPSSWGGLQHLSPCPVSELTDTAGLRGSALGLPQACQPEELLCFSCQMCMAPEHQHHSLRDLPVHNKFSNWCGVQKGSPGGLDMTEEELGASGDLSSEKQEQSPPQPPNDHSQDSEWSKREQIPLQVGAQNLSLSVELTEAKLHHGFGEADALLQVLQSGTGEALAADEPVTSTWKELYA,FSVGIPLPHCHLGLTLHTKHQRKHHQKSICHRLLPTLQGQGASARTACIPQVMGSPAQPEQPWPGREPQLQTLASPVPTLLASRKWRWGLSSPIRWARAHLGNQLTNSQGMSQRSSPLLPRPEGRRDQTLATHKLGGEKKGTLGPTRLLREPVAIPCILMDPGRLLGTERQSRLFGQNTNHLLQAGHQKGIRGFWQLGSEILPKSPLTCLLAVLRDNKIQGTQTPWSHSQISAQWIIQEKKTMIYLTQIATTHWILSHVSMPKPSHSQRRGNGISQSQRTLKVMTANYLRTHWLRRGTKAPKTGGAIVPPTTVANPGPELELLGASLQPQTVTYLLKLIGASPWIALMQRKNWGKISKKNLSLVQLTRYPQRLFGTWRTLVCLWTKRQYAGLVPSTTEQQLGWMPSCQAVRFTLILSSNPIVSSNPIVSSNPIVSSSPIVSRLNHRSQATLNKPTLSKACSFQERAHCPWIPGFPVTLRSTPAAPQEWVLYVQVLICRNFTPVRGRGLDTGQILRNSHQMQKRFCHIAPNCTKAVLSSSAVQEMSTQPLLLIRLGCLSGEFKGLFNQELMAPFRADVSLTPSRAALKHPTILAYQTCWLPLPPPLMAAPMKGIGLPFSRSTSLNSLVLFWRPEHPSQLTPTLRKTLVPWPKLLAKEEILYCQLALGYLAIISTTFQSICPESGVGQRKNRTVMPNKVFQISLALVRKRRVMTKLIRQTNHCLLLDLQMHRSLQQRTRYQIPQKHVKSSRTTWKNAFRVAGNLDLPLMRIFSRRTLVTVMSLQPPKQTIGPKAGLLSGKIVQSSQGNVPTATTHRKRRQIARRALRKQLEDTMFPLPFLQVQSYTFTLLPGIHCHLPCSPHSWKHSMPKAGMPQKLPRFQLAEKGYPPHPPGKPGALVTTTKLSKVLIRIICQCCYKTRILRLPHLSRSQLRYQLIIPGKSSENQVNALEILQKKAMIQFILLLLRTDIFSPLPAQKYVNLKTKLFIKNTVFQHLREERSLLSPVAVLPQTALSLGSLSSFVNLRHERKKSWIRIRFGRPSMALRKTCQGKVLFLNPDQIVEAAQWWPRVVAQPLSGKGKMKLGFLKKVFVPKIAQKSLSFQVQSLHMKGSSLHALRKETPVNASHKKCIPTENLLERNRIKELIILMKWLGLGVCSWKMASKLNLSRISRFMLPTHQEPIRSWCSRTRRSRRRLTMPLGQTALETLCPLRISHLLQDRQMILSLGIVKLERWRLTALGTIPRSRKSPQTPSGQGKVYERVNLESTPTQLDRTDLPGIFVILGNTQLAESSPTLLFTHREKHWLELCHCNPGRGLLRIMASLKHQQVSKGSLGAEVLRNWRLKVFRKAKLNTVVPTKKSQKLKVKLKKCLCKGEAAFRKKIKLRNFLVSASFVGTRFSGRKLSAHYAGQNSVQLLFTKTVIPCPILQGGQEGVFMYLLLASLHLTVCWISQCKFITVPWLESIRTRVRRPEATAPKEMLEGVPLRHTLPGVGLCDPWPWDLIVNLVYQRAFLWGQRTGSQQAPAPKTMERTSESPCWVSVPVKILLLKPRWLYKKKESVHTRSLASLKRGSASPWKRIVTKPASQGRRQRRRLRTSDPAVFPHLFPCRGCPVQSLGCWSPLTMHPCAWPSWRRSDRQRPRESSFMTLWPGAQSFLTVKLYNPNVLQGLLAGLSVNKTSHHQTRPGMRVKHRDFMWHLYLLKQGRICYLMRGKSRPHLCLQTALNLCPIRKLTESHGILCRLSPMLLLLKTGNVVLENGSSREQVNHLYVTLVLLKSRKRKMQPEHLPQLILWPQTVLVLQHLWRRSGGYQRRWLPYLLRPLMMILELCMSVSQFRRRLQRAYPLAVRTAAQSIRNPELTPHMEKFQIICLHREKKQPILKVSLPVMFRILQVPQGLSKTMSNALRLLLALKKVGQVPNKIPFCLELQGLHWKLPHSSVCSVRRVLGLGQKSAGLAANIPGQFHCQIKDQAQILGELGRKPHVDTQGKLMALSSQGTLKAAGLSARLEGKRAELFLADSHAVLNLLLLMLIPPIPLLYCVLEMVTGRSLSRLPHILSTHPVYLPGPMKWMRQERSLGDLMCTHMALSPKMLTGNLGQRAALVSLLLWLLSYLELKAADPLLLLTGQVPSATQLLMEAWGGFLRKRLLRSKQAQNLRLPLSLQACTLSPGSLGTALVTRMHRCVKPIQNHLQQLRDHTPWIVKGLLRASWWSHSMNVKIPLDVFWKSHNFPLSGITIAWIPKPSLQGNIPAAPRKTVPGRKKSSTETRLQVVEKASPRVIPFLMKMAMAVRFMLGERRWLWPSLLCPRFYHRASKTQPLCPGKMKHRSLLLRGVATSTLAESSQHPTTGAHFLLQSSLAPNTPGPPPHHSSQLSALLVLFRSTVWSLLPLQTKIHRGLTDCGTHISGAIPQESQWQEHLCRLRTAIRKPHLAWMMGLPITGTSLPPLLIQCLPLSHTCQPLISRPAGCLVLWNKPNRESERNWVSRLGQKIGALRWTKECCTLAPVTSVPMRCRGVRRSLHVSAGSSICLAVQSMFPAARSPRGHYQMWPGAPAWTMAKTRTPLSTPTSALTPIFVICQPHTAALRMPRVQMRPGKYSEGVLQLPETPTSRRALKEPPLRVMTEGLSSGALLVKQTVGVSPPWPKEVLQVQWMRLCCCIHQRQAALWDRPGRTHSNRAHRPSAAGATGAALTSPLLSLKPVQYQPLIWPHGPACTICLSTSHSSCTVPQSCLGVSPSQMWPEGSRTPRGTSQIKPHRPWMALLRPLWMRAARLTSPYPPCASRLQRLNLREPMSLKGAQIPRLCLKKREMCQGYLRRERQRKQHRKWLSSSIFRKKALPTSPRALQYPHPTGFRKPPLGSIFLLAPQFLMLSCLPAPSQRSHIALSAVPVPAPLIPQGSFPVLPSILGTPGSRRSWAPQVLCSWTGPPPQSSLLVPAPKSRVFPQALPSQPLQLTLLKATRSLTPAQTLLMPQGLQWIIIPKPLTSVAPREVEVPYKGVMGDPSLSCTPHTAHSRVQNSNLVSGSTLSSFSPGQLSGSKADCCHHHGTGAKGWATALCLRRWLPRSIAHAVGSQVSGRAGQKMEVRVQHLQGNHNALWTDLLHGEASSTSAPALSLSLILQGSEVLPWASLRPANLRSYCASVARCAWPLSTSTTVGTSRCITNLVTGVGFRRAHLGGWTLRRSWGPAVISALKSRNRVPHNLLMTTARILSGPRGSRSPCKLGPRTSHSAWNSQKRNCTMALGRPMPCSRCCRVGQGRRLLLMNLHPPGRSSMH

Amino Acids from 3' Exons

EEDKLHTLANSSSLCTSSNGSLSSGMTSGYNSSPALSGQLQFPENM,KRINYIPWPIPAPCAPALMEASRLAPLAIIAAQPCQASSSSQRI,RGTTYLGQFQLPVHQLWKPLVWHDLWLQPSLVRPAPVPREY