McDonnell Genome Institute

Washington University

CircRNA

chr15|42547260|42548456|-|LRRC57|ENST00000569830.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9001

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

2

Peptide

RSPLYTQMLSGILMAPSPSK

Amino Acids from 5' Exons

FPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLSMALAREAFASDQLLPGVVFSYKLIFVFVMKPCRRAQVANAGILEAFFLLLVITSKISLIMIGCYNDCYWVNLDLKEKNILGMCKQSYLTWNGGWMRRGGSSKYHKIAVGLCLGPLYKRSPLYTQMLSGILMAPSPSKDYVGKMQYLKMAHVGVLHILTRGEAGCHIVFINFIKVVFSSITFRFKNFSLPAVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQ,SPQTCRSRAISGPSTCPTTRSKAYRLCESSLCRASPTTTNVWLSPGRLLLVISCYQGWFSLTSFLFLLNRAGGLKLRMPESLKPSFYFLLHLKALLGVIMIVTGLIWTKRRTFWGCNVNKATLGMGDGEGEDLPNITKLLSDCALGPFTKGAHYTHKCSPAFWHPHLLKTMLVKCNIKWHMWEFYIYQEAKQAAISLTSSKLFSALSHSGFKKIFLCQLFCLMRYAIKNRRATTITLESCRLPLGNSLPSRPASLGTNWEHYLPNFVAYGTWMWISLRTRFEVYLTQWESCKSSNSTSTRI,PRRLAEADEQSQDHRLVQQQDRKPTAFADRKVHSAEEPLPEQQQTEYGSRQGGFCSAVTRGGFLLQADFCFCYETVQEGSSCECRNPSLLSTSCNYINKPYNDWVLLLLGFGLEREEHFGDVMTKLPNLEWGMDEKGRIFQISQNCCRIVPWAPLQKEPIIHTNALRHFDGTLTFRLCWNAISKNGTCGSFTYINKRRSRLPYSLYKLHQSCFQLYHIQVLKKFFFASCSADMQSEKTRDAKPKQQSPRAAVYLWATLCPQDPEPLWEPTGSITSPTLPTAPGCDGSLEPDSKYTLSGRAASHRTQPQPES

Amino Acids from 3' Exons

GPEPRRDGKQCAPRSCGNGAENWCLSAGPRADR,DLSRGARMGNSALRAHVETAQKTGVFQLKDRGLTE,TAAALGWETVRSALMWKRRRKLVSFSLRTEGP