McDonnell Genome Institute

Washington University

CircRNA

chr15|42184516|42199961|-|VPS39|ENST00000318006.9

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9522

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

8

Peptide

CALNWTDIPVAMEEWLLVGTK

Amino Acids from 5' Exons

VDGKGSIKELFPTGKQLEPLVAPLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAM,WMERGPSKSSFQQENSWSPLHLWQMEKWLWARMISPWYSMRKGSAHRNVPTGRTYQWPW,GWKGVHQRALSNRKTAGALSCTSGRWKSGCGPGSHRGTQGRDLHTEMCPELDGHTSGH

Amino Acids from 3' Exons

RNGFLWEPNKDIFFSIGFGRTL,GMASCGNQTRTSSSLDSEGR,EWLLVGTKQGHLLLYRIRKDV