McDonnell Genome Institute

Washington University

CircRNA

chr15|41834739|41835223|+|JMJD7|ENST00000397299.8

Cancer

Type of Peptide

BRCA-Luminal A

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9935

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

4

Peptide

STSTGTGSAPTGR

Amino Acids from 5' Exons

SSACLLLCPTWTNPQLRSTSTGTGSAPTGRALSATLCSTGRPSRSGPSPIS,ALRASCCALPGQTPNSAPLLPGLGLPQQAVHYPQRSAALAGPPEVVPPLFQ,LCVPLAVPYLDKPPTPLHFYRDWVCPNRPCIIRNALQHWPALQKWSLPYF

Amino Acids from 3' Exons

SHSGLHRGECGRDPRWLRGCRERGSLHDASAPPAPELRAGCAGGPGPAPWSPLCAEAVLQPAQRAAPAAASGIPCALGLRSP,ATVGSTEVSVAVTPDGYADAVRGDRFMMPAERRLPLSFVLDVLEGRAQHPGVLYVQKQCSNLPSELPQLLPDLESHVPWASEAL,PQWAPQRVWPPQMVTRMPEGIASCQLSAACPASCWMCWRAGPSTLESSMCRSSAPTCPASCPSCCLIWNPMCPGPPKPW