McDonnell Genome Institute

Washington University

CircRNA

chr15|41739905|41754567|+|MGA|ENST00000564190.1

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

LLLGQMGALHPANR

Amino Acids from 5' Exons

VNGKSYPQAKLLLGQMGALHPANRLAAYITGRLRPSVLDLSTLSTVISKVASNAKVAASRKPRTLLPSTSNSKMASSSGTATNRPGKNLKAFVPAKRPI,LMVRVTRRLSCYWDRWGHCIQPIGLLISQAGCDPQSWTSQPSVLSSPRHPMPRWLHPGNHVPCCLQHPIPKWHPPLALQQIALGRIRRLSQQNGQL,WELPAGVAIGTDGGIASSQASCLYHRQVATLSPGPLNPQYCHLQGSIQCQGGCIQETTYPVAFNIQFQNGILLWHCNKSPWEESEGVCPSKTAN

Amino Acids from 3' Exons

NNCVEYIEDDEEHVDIETVEELSEEINVAHLKTTAAHTQSFKQ,ITVNTLRMMRSTWTLRLKSSQRKLMLLTRPQRPTHSHSNS,LCRIHGGARGHDCRRALRGNCCSPEDHSGPHTVIQTA