McDonnell Genome Institute

Washington University

CircRNA

chr15|41668827|41711349|+|MGA|ENST00000219905.11

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9327

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

12

Peptide

ADVSLTTLLTAQDGK

Amino Acids from 5' Exons

DGKAIVTMWLQLSYYVSYNHGGETADYIGSRWWNSGRSSTYLLCHLKAARKWQNSRNFGYSGCLCFGCVITSKIREDLPSSLYCGWNHCYPRQYVEVLSSKHRDDSDQARKTHVSLLSLLDNRFRFKFEVYSCHGYISCGPSLVEWSLVGTWEGTSCFGEGFHSSRISFHRSLLDASTSIFLTQTYQQYTGPRRAYHLALYASLPAEASFGACRKGCGGDTIKWPWCPHFYLPTDILCSNSLSEHSDYSAENRLQSICQRLSGWAEAPERWKTKEQLPRREYFQFFWSSGPSYRRSGVRDTTRFGSFVKGSNIRQGFGEDFPYKTRLSWFHGYFSTSSSIEARDFM,MGRPLLCGDYSCLTTEFPTEIMEEKQQIILANQDGGTVAGAAPTFFVILKQPGNGKTDQGILVTNQDACALASSVSSPVKSKGKICLPADCTVGGITVTLDNNSMWNEFYHRSTEMILTKQGRRMFPYCRYWITGLDSNLKYILVMDISPVDNHRYKWNGRWWEPSGKAEPHVLGRVFIHPESPSTGHYWMHQPVSFYKLKLTNNTLDQEGHIILHSMHRYLPRLHLVPAEKAVEVIQLNGPGVHTFTFPQTEFFAVTAYQNIQITQLKIDYNPFAKGFRDDGLNNKPQRDGKQKNSSDQEGNNISSSSGHRVRLTEGQGSEIQPGDLDPLSRGHETSGKGLEKTSLNIKRDFLGFMDTDSALSEVPQLKQEISE,WEGHCDYVVITVVLLLSFLLKSWRRNSRLYWLIKMVEQWQEQHLPSLSSSSQEMAKLIKEFWLLIRMPVLWLVVCHHQNLKGRFAFQLIVLWVESLLPSITIVCGMSSIIEAQRFPSKEDACFLTVVIGQVIQISIFLSWIYLLWITIVISGMVVGGNLVGRLNLMFWGGFSFIQNLLPQVIIGCINQYLSINSNLPTIHWTKKGISSCTLCIVTCRGFIWCLQKRLWRYNMALVSTLLPSHRLNSLQQLIRTFRLLSKITIHLPKAFGMMGIISPREMENKRTALTKKGIIFPVLLVIGSVLQKVRGQRYNQVIWILCQGVMKHQARVWRRLPLINETFLVSWILIQHLVKFLNSKRFLN

Amino Acids from 3' Exons

VEIQKVHKIVLLSVVISMNTWKMKASWKQAWVFLLMLPHLLWCTSFPLRVPVMYEHLIVYRSNLLFPLLPLILNLILYPLSLERQSLKTDRQLSVAELNHLINPFYHTLFHQSRNTLMFEIRLPRILQASSQKIRRITLLCQLWMKIYFQSRLVCGRHSSSSNSNREVALQACLNLRSWTWKTVHFGKENQGHTSQKSEQMYPQLYLQL,WKFRKFTEKSFCFLARILGKRQADGNKHGFFFCSHISCGVPASHEYQLCTNTCTKEAIYYFPFYLLFFETSFCTPCLSKGKVSKQTGNFQWPNIILIHFTIPCFTKAEILSCDSRRGYQEFFRHHLRKSGELCCANFGKYISKADFAAGTAAAATATGKSPSRLVISGEANGPGRLCTLGRKTKDIHHRRASRCILNNSTYSS,GNSESSLKNRSAFCSDKLDEYLENEGKLMETSMGFSSNAPTSPVVYQLPTKSTSYVRTLDSVLKKQSTISPSTSYSLKPHSVPPVSRKAKSQNRQATFSGRTKSSYKSILPYPVSPKQKYSHVILGDKVTKNSSGIISENQANNFVVPTLDENIFPKQISLRQAQQQQQQQQGSRPPGLSKSQVKLMDLEDCALWEGKPRTYITEERADVSLTTLLTAQ