McDonnell Genome Institute

Washington University

CircRNA

chr15|41044903|41048276|-|INO80|ENST00000361937.7

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9184

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LYPTVSLSQK

Amino Acids from 5' Exons

MVSSFPVSESLLQAPSATLLGSARRGEPPEIPEEQGFPSWGFSTLLSKPLQLPFVK,WLALFLSLKASYRLHQLRSWGAPEGESHQRYLRNKDFLLGVNFPLSFPNLCSCPLLK,GLFSCLKPPTGSISYAPGERQKGRATRDTGTRISFLGLIFHSPFQTFAAALC

Amino Acids from 3' Exons

VVKGSFSICTRLYPTVSLSQK,WLRVLSPFAPDYIQRSLFHRK,GGFFLHLHQTISNGLSFTEK