McDonnell Genome Institute

Washington University

CircRNA

chr15|40934547|40935117|+|DLL4|ENST00000249749.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

21

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

GPTMLVNVPPTSPAPTARR

Amino Acids from 5' Exons

ISTTAPTTPHARMGQRAPTVGSEATPAPVAQATLVWTVSWSSASVTATPVAMEAAV,SQLLHPPLPMQEWGNVLQQWAAKLHLHLSPRLHWCGLAGAQRVQQPLSQWRQL,LNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCK

Amino Acids from 3' Exons

DQEDGYHCLCPPGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCAN,TRRMATTACVLRATMACIVNTAPAAPTPPASMGAPAGSATRGPTMLVNVPPTSPAPTARRKWTGAPATPVPT,PGGWLPLPVSSGLLWPALTQHLELRRLPLLQWGLLPGAQPGGQLCLMSPQLHRLQLREESGQVHQQPLCQ