McDonnell Genome Institute

Washington University

CircRNA

chr15|40844489|40845029|+|SPINT1|ENST00000344051.8

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9958

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

SYLPGVPHR

Amino Acids from 5' Exons

VTSTLGTQRPALRPPWGGRRWPLRGRWPAPASPRPASLPSPCGFCARSASRAPRPGHRPRPLGCPREPTATALPPGCLASCWTPTPRSATELPSWSPPPCAGAGTACAPAAPPRTATWRWSCSPTAGRTPSPPASSSTASTSRTSCASSRPGRASSTTSRGKCTAPTASCGPRALE,SPAPSEPRGPRSEGDPPGEEGDGPCEDDGPRPPRPGRHPCRRLVASVHARPPGHPGRATARAPWAARGSRLPEQLYRRGAWLRAGHQRLGQQRSYLPGVPHRAPGLGLRARLLHHPELQLGASGAAARPRGGRHRRLLPHQLPLRAELRVQVRAQGGLHQLPHEGSVPLLPPAADPGLW,HQHPRNPEARALKVTPLGRKAMAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFG

Amino Acids from 3' Exons

VTSTLGTQRPALRPPWGGRRWPLRGRWPAPASPRPASLPSPCGFCARSASRAPRPGHRPRPLGCPREPTATALPPGCLASCWTPTPRSATELPSWSPPPCAGAGTACAPAAPPRTATWRWSCSPTAGRTPSPPASSSTASTSRTSCASSRPGRASSTTSRGKCTAPTASCGPRALE,SPAPSEPRGPRSEGDPPGEEGDGPCEDDGPRPPRPGRHPCRRLVASVHARPPGHPGRATARAPWAARGSRLPEQLYRRGAWLRAGHQRLGQQRSYLPGVPHRAPGLGLRARLLHHPELQLGASGAAARPRGGRHRRLLPHQLPLRAELRVQVRAQGGLHQLPHEGSVPLLPPAADPGLW,HQHPRNPEARALKVTPLGRKAMAPARTMARARLAPAGIPAVALWLLCTLGLQGTQAGPPPAPPGLPAGADCLNSFTAGVPGFVLDTNASVSNGATFLESPTVRRGWDCVRACCTTQNCNLALVELQPDRGEDAIAACFLINCLYEQNFVCKFAPREGFINYLTREVYRSYRQLRTQGFG