McDonnell Genome Institute

Washington University

CircRNA

chr15|40813337|40814070|+|ZFYVE19|ENST00000299173.14

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9178

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

19

Peptide

MPPYAALAAMGTSSVPAASVTLQDYR

Amino Acids from 5' Exons

PSRTIASQTVMTTRMRRQPSKESCS,DPPGLSPPRQRRGGDSHPKSPAA,TLQDYRLPDSDDDEDEETAIQRVLQQ

Amino Acids from 3' Exons

AQDVDPRPEAEEEELPWCCICNEDATLRCAGCDGDLFCARCF,PRMWTPGLRLRKRSSPGAASAMRMPPYAALAAMGTSSVPAAS,PGCGPQAGGRGAPLVLHLQGCHPTLRWLRWGPLLCPLLP