McDonnell Genome Institute

Washington University

CircRNA

chr15|40751425|40752178|-|RMDN3|ENST00000260385.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9978

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

CLSAAQPSTGR

Amino Acids from 5' Exons

MPHGREPESGSAAKVSVCPGEELHWLQLCLLHGLLGSHVHRCERG,CHMEENQRVARRRRFPFVRERSDSTGSSSVYFTASSGATFTDAESEG,ATWKRTREWLGGEGFRLSGRGVTPLAPALSTSRPPREPRSQMLRVKG

Amino Acids from 3' Exons

CSCGLSQVGLEMPQCCPAFHGKDRRRCWTAWTLCPALWRCGGRWRSEAACEGLRGRLLGRS,DAPAGCPRWGWRCLSAAQPSTGRTGEGAGPPGLCADQPCGAAAGGGGAEKQPARACGGDCWGGP,MLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTSLVALRREVEELRSSLRGLAGEIVGEV