McDonnell Genome Institute

Washington University

CircRNA

chr15|40298561|40298964|-|PLCB2|ENST00000260402.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9025

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

3

Peptide

AGPGQAAAPPR

Amino Acids from 5' Exons

ASCHLKAWSGFSVGQRTACWPRTSCCSTTTRSHSIITSSTRPTTPTQ,PAVTRHGLVSLWAREQRAGPGQAAAPPRHDAATQSLLHQLVPQHLPD,QLSPEGMVWFLCGPENSVLAQDKLLLHHDMTQPLNHYFINSSHNTYLT

Amino Acids from 3' Exons

PCGQTLHDEGAPDQIHQPETAGLPALPAVPASTAPGAGPHRQVAQWHQCTE,HAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQR,MLRPNPTRRSTPNSSTRNSGTPGLTPCCSRQHGLTRCRASSTSMSPVASMHRG