McDonnell Genome Institute

Washington University

CircRNA

chr15|40176476|40218562|+|BUB1B|ENST00000287598.10

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9416

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

18

6

Peptide

LSQNISEGVYAMSLWICTVTCTTK

Amino Acids from 5' Exons

GRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQQKAEPLERLQSQH,GVYAMSLWICTVTCTTKGLVFHLLSSISHGQKNMKLEKTLGKQMRYFRKGFNRRLNHKDYSPST,AFMQAFGYVQLLAQPRDWCFTCSVLYLMGRRISRKLESRCDISGRDSTEGTTRKTTVPAP

Amino Acids from 3' Exons

VDLFGIADLAHLLLFKEHLQVFWDGSFWKLSQNIS,TCLVQIHIYYCSRNTYRSSGMGPSGNLAKIFL,RPVWYSRFSTFTIVQGTPTGLLGWVLLETPKYF