McDonnell Genome Institute

Washington University

CircRNA

chr15|34870751|34873999|-|AQR|ENST00000156471.9

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9624

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LTPCAALAR

Amino Acids from 5' Exons

NLGEAEYVVALFMYMCLLGYPADKISILTTYNGQKHLIRDIINRRCGNNPLIGRPNK,ILERQNMHFLCTCVYLVTLLTKSVFQHIMAKSILFATSSIDDVETIHLEDQT,SWRGRICSSTFYVHVFTWLPCQNQYSNNIWPKASYSRHHQTMWKQSIDWKTKQ

Amino Acids from 3' Exons

LVQPLQLAIQESRKLTPCAALARVYSKCWLTVLPAHCRFSRSGRITSLLLS,LCNLYNWRYKNLGNLPHVQLLPEFSTANAGLLYDFQLINVEDFQGVGESEPNPYFYQ,CATSTTGDTRIETYPMCSSCQSLVQQMLAYCMTSSSLMLKIFKEWENLNLILTSI