McDonnell Genome Institute

Washington University

CircRNA

chr15|34245284|34245867|-|SLC12A6|ENST00000290209.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.967

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

6

Peptide

LDLVAPILSMFGDAVK

Amino Acids from 5' Exons

VFGHSKANGEPTWALLLTAAIAELGILIASLDLVAPILS,FLATAKPMGNLPGLYFLLPLQSLEYSLPPWILWPQFFP,FWPQQSQWGTYLGFTSNCCHCRAWNTHCLPGSCGPNSFH

Amino Acids from 3' Exons

VRCCERFGGRHLILAIPMGDCYWLLLFNMWGWTSEPHRCTEAATSYCQGHHTVSE,FGDAVKGNLVVGTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLR,SVMLKVIWWAPYLGHPHGLLLAPSFQHVGLDFRASQVHRGCYKLLPRITSYRF