McDonnell Genome Institute

Washington University

CircRNA

chr15|34003031|34003209|-|AVEN|ENST00000306730.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9738

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

9

Peptide

LSLTGIDIK

Amino Acids from 5' Exons

VEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSA,LKMTAMQRPMEKRMMNREIILKERLSLTGIDIKILKKRSIMKVESHRGEQISVSSLALQ,RQRCRDLWRRETGKLFKKDCLLGSISRYKRGQKWRVTEGNRFQCPPLC

Amino Acids from 3' Exons

VEDDSDAETYGEENDEQGNYSKRKIVSNWDRYQDIEKEVNNESGESQRGTDFSVLLSSA,LKMTAMQRPMEKRMMNREIILKERLSLTGIDIKILKKRSIMKVESHRGEQISVSSLALQ,RQRCRDLWRRETGKLFKKDCLLGSISRYKRGQKWRVTEGNRFQCPPLC