McDonnell Genome Institute

Washington University

CircRNA

chr15|29761138|29762438|-|TJP1|ENST00000346128.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9491

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

28

2

Peptide

LVDHTIGLPAAAGHDLLTSGQSLLIIPGTR

Amino Acids from 5' Exons

TFQKFSHWHQIILVDHTIGLPAAAGHDLLTSGQSLLIIPGTRRSSQAMA,HFRNSVTGIRSFWSITRASPPQPVTISPAVRAFSFQALAAAAKQWQ,ISEIQSLASDHSGRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNG

Amino Acids from 3' Exons

NMVFDWQAIYLLRKFHKIVWQQEMAIFKKVMLY,IWSSIGKPYICGNFTRFGSKRWQYSRRCCIE,YGLRLASHIFVKEISQDSLAARDGNIQEGDVVLK