McDonnell Genome Institute

Washington University

CircRNA

chr15|29720357|29773357|-|TJP1|ENST00000346128.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9673

164

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

14

Peptide

IDSPGFKPASQQAPGFGFGIAISGGR

Amino Acids from 5' Exons

ADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRIDSPGFKPASQQ,RMVLQVMTLICMMIVCPTCQLQVVNTQCIARTVDTLLTMKTQTQKAGPTLIKNMKLLMMRLGLHRSLPLHGPLSLERTPLECIMKTKHILLTHHKRSHNQFIETPLDLSQPLN,GWCYKPFASSVLPVSSRILNVHGQTHFLRHRHRRRGLHSRTRNSGWDSTGVCHYTVLACKRGLLWNASKPNISSLLTTSAATTNSNRLPWIASLST

Amino Acids from 3' Exons

APGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQL,LLDLDLELQYLVDEIILIFRVGKRQFQMCKEDQLKDSY,SWIWIWNCNIWWTRSSFSEWGNVNSDFRCAERRTSRTAT