McDonnell Genome Institute

Washington University

CircRNA

chr15|29718020|29733313|-|TJP1|ENST00000346128.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9071

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

LCTVYRR

Amino Acids from 5' Exons

PPEVASKPSGAPIIGPKPTSQNQFSEHDKTLY,LQKHLNLQVLPSLVPNPLLRINSVNMTKLCT,SRSSITFRCSHHWSQTHFSESIQTQNSVQ

Amino Acids from 3' Exons

FIVALNQMEILSILEPILNMKRNLPMDLVLTKERCSVLWIPCTMENWALGLLFELVKIIRRNEASSLIRT,LSSHCRIRCRRFFLYNPFIKGISLWTFQRRGVPCCGYLVQWKTGLLACYSNWKSGGRTRHHPEQ,YRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAIRIGKNHKEVERGIIPNKN