McDonnell Genome Institute

Washington University

CircRNA

chr15|29704161|29705745|-|TJP1|ENST00000356107.10

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

15

2

Peptide

LPHCASMTPDGWSFALK

Amino Acids from 5' Exons

VKHCVLWCVVPMASSSSLWSCAYHTVRPLLTVGLLLNHPTPRR,NTAESFGDVWSPWPQVPEACGAALTTLCVHDSRLVFCSKIIRLLV,ETLLSPLVMCGPHGLKFLKPVELRLPHCASMTPDGWSFALKSSDSSS

Amino Acids from 3' Exons

SFSCGRGRRWSYCGGHSPRHIQQWGRAEFHRNWCYNYPSRSHSRRSAGNLFQGLPGQQHPSTFRRE,PSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEK,LQLWKRMKMKMVILWWPQPEAYLTAMGACVPKLVLVLSLKEPFPKELSRKSISRSAGTTASFHLIKRK