McDonnell Genome Institute

Washington University

CircRNA

chr15|28280067|28299516|-|HERC2|ENST00000261609.11

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.995

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

14

Peptide

KSLHSQEMGSVVCGMK

Amino Acids from 5' Exons

MMNRSVFLCWLKSSRPWPSSQPPPPSQPCDSSRGWSWSAISLPIEPFFRRMSKLSGKAAVFLCLLWTKK,CETEGVSFCAGRAAGPGRPVSHHHPLSPATQAEAGDLGALFHCLENRFSGECQSVEKQRYFSASCGQKK,VNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKK

Amino Acids from 3' Exons

LAFTRDGLCGLWNEMVKDGEIVYTGTESTQNGELPPRK,LHSQEMGSVVCGMKWLKMEKLYTLEQNQPRTESSLLEK,CIHKRWALWSVENGRWRNCIHWNRINPERRAPSK