McDonnell Genome Institute

Washington University

CircRNA

chr15|28262917|28280287|-|HERC2|ENST00000261609.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9733

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

5

Peptide

LLEGLQDVNELK

Amino Acids from 5' Exons

GKCGLGEMVTMGNWAEVVVMAAKPQSLKSFKTWMWSKSAVEVSFPLLRKMAKFIHGEKVTTRDLDMEQRNMFVIQNSKACK,ASVVLGRWLWEIGQRWWLQNPKADKASRLGCGQSPLWKSVFHCFDERWPSLFMGKRQPETWTWNRGTCSLSKTLRRLA,QVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQ

Amino Acids from 3' Exons

MMNRSVFLCWLKSSRPWPSSQPPPPSQPCDSSRGWSWSAISLPIEPFFRRMSKLSGKAAVFLCLLWTKK,CETEGVSFCAGRAAGPGRPVSHHHPLSPATQAEAGDLGALFHCLENRFSGECQSVEKQRYFSASCGQKK,VNELKECLSVLVKEQQALAVQSATTTLSALRLKQRLVILERYFIALNRTVFQENVKVKWKSSGISLPPVDKK