McDonnell Genome Institute

Washington University

CircRNA

chr15|25356690|25360527|-|UBE3A|ENST00000232165.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9599

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

13

Peptide

GTFRDLGDSHPLEMIAMENPADLK

Amino Acids from 5' Exons

VCSHTMNLQNCFGLIHLLLKLRVSLLLAYWVWLFTITVYWMYIFPWLSTGSWGKKELFVTWETLT,YVHIRIYKIVLVSIFFNGSVYSDWHSTGSGYLQLYTGCTFSHGCLQEANGEKRNFSLGRLSP,MFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHP

Amino Acids from 3' Exons

LEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDI,RSLWKILQTRSSCMWNLKENKELMREVFPKNFFSWLWRKSSIQIL,RDDRYGKSCRLEEAVVCGIRRTRSGRCFQRIFSAGCGGNLQSRY