McDonnell Genome Institute

Washington University

CircRNA

chr15|25355891|25360527|-|UBE3A|ENST00000232165.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

KLEMIAMENPADLK

Amino Acids from 5' Exons

VLYQSLKDLLEYEGNVEDDMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRK,FYIRVKIYWSMKGMWKMTSLSRYHRQIFLVTQCMIRKMVIKFQLQMKTG,SISEFKRFIGVRECGRHDDHFPDITDRSFWPNDVSKGKWNSNYKKQE

Amino Acids from 3' Exons

LEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEIFNPDI,RSLWKILQTRSSCMWNLKENKELMREVFPKNFFSWLWRKSSIQIL,RDDRYGKSCRLEEAVVCGIRRTRSGRCFQRIFSAGCGGNLQSRY