McDonnell Genome Institute

Washington University

CircRNA

chr15|23008698|23011331|-|TUBGCP5|ENST00000614508.4

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

IVHDAER

Amino Acids from 5' Exons

VGRILASYEEFFLNGRRRYHVLLHVNFNKRKGNMAECVFSCPTPRSSRTALSRFT,LVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRYPEDSS,WNTCKLGIFSWKEEIPCMTSTRQFLIKEKRKHGRMCLFLMSNSKKQDSVILKIVH

Amino Acids from 3' Exons

MQKEKVYTLSFWNLYSPVFDMEKIPLHRFLLSNRQPRRTRCSPLLKAILNWMMFMIHCLPLTLQ,CRKKKFIHSLSGICTVPSSTWRRFHSTGSYATGNQGEPDEDAVHCKPSTGCSSTACHLCK,AERKSLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQSIAESHLELDDVHDPLLAINFA