McDonnell Genome Institute

Washington University

CircRNA

chr15|101054945|101057050|+|LRRK1|ENST00000388948.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9599

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

ILPLYPWDTCSPKK

Amino Acids from 5' Exons

ILPLYPWDTCSPKKPTRSPRAWPTCTRKTSSSVTSRTTFWCGPLTSRSTSTSSYLTTGFRGSHSMRAPAWRALLATRPQRSGLALYMMR,FFLYTPGTHAHPKNSLPDRLGPGLPAQEKHHLLPEVGQHSGVVPRQGAHQHQAILRDFEAVIPGRPRRGGHSWLPGPRDQASHCIE,SSFIPLGHMLTQKIAYQIASGLAYLHKKNIIFCDLKSDNILVWSLDVKEHINIKLSDYGISRQSFHEGALGVEGTPGYQAPEIRPRIVYDEK

Amino Acids from 3' Exons

VDMFSYGMVLYELLSGQRPALGHHQLQIAKKLSKGIRPVLGQPEEVQFRRLQALMMECWDTKPEK,ICSPMEWCSTSCCQDSALHWATTSSRLPRSCPRASARFWGSRRKCSSGDCRRSWSAGTLSQR,RYVLLWNGALRVAVRTAPCTGPPPAPDCQEAVQGHPPGSGAAGGSAVPATAGAHDGVLGHARE